PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G02591.1.p
Common NameEUGRSUZ_G02591, LOC104454022
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 296aa    MW: 31702.3 Da    PI: 6.742
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G02591.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.73.7e-101154344
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      +W+ e d+ + +a + ++ +   +W++Ia+ ++ g+t +++k ++
  Eucgr.G02591.1.p 11 SWSREQDKAFENALATYPEDsadRWEKIAADVP-GKTVEEIKRHY 54
                      6********************************.**********9 PP

2Myb_DNA-binding45.61.6e-14122166347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
  Eucgr.G02591.1.p 122 AWTEEEHRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 166
                       6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.128762IPR017884SANT domain
SMARTSM007172.0E-9860IPR001005SANT/Myb domain
SuperFamilySSF466891.59E-111166IPR009057Homeodomain-like
CDDcd001679.84E-101154No hitNo description
PfamPF002492.0E-81154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-51155IPR009057Homeodomain-like
PROSITE profilePS5129418.201114171IPR017930Myb domain
SuperFamilySSF466892.84E-17117172IPR009057Homeodomain-like
SMARTSM007171.1E-11119169IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.6E-17119169IPR006447Myb domain, plants
PfamPF002492.2E-12122166IPR001005SANT/Myb domain
CDDcd001673.50E-11122167No hitNo description
Gene3DG3DSA:1.10.10.601.1E-11122165IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MTVDETTSDC SWSREQDKAF ENALATYPED SADRWEKIAA DVPGKTVEEI KRHYEILVDD  60
VNSIESGCVE LPPYSCSPEG STSHGGDEMN SKKGSHVGNL HGNLNHEGKA SRSDQERRKG  120
IAWTEEEHRL FLLGLEKYGK GDWRSISRNF VVTRTPTQVA SHAQKYFIRL NSMNKDRRRS  180
SIHDITSVDN GEVSTPQGPI TGQTSSSVAG VSSSKPSKQP FQPPTGPASI GVYGAPMIGQ  240
PIGGPLVSAV GTPVNLPGPS HMAYGVAPVP GAMVPGAPMS VGHVTYPMPH ASAQR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-1812771176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G02591.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067026.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_010067025.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_010067024.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_010067023.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_010067022.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_010067021.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-66DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A059BG480.0A0A059BG48_EUCGR; Uncharacterized protein
STRINGGLYMA07G28310.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-113MYB family protein